PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10023692m
Common NameCARUB_v10023692mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 309aa    MW: 32712.1 Da    PI: 6.5244
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10023692mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.71.5e-191459147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd+ll  +v+++G+++W++I++ ++ gR++k+c++rw + 
  Carubv10023692m 14 KGPWSPEEDDLLQSLVQKHGPRNWSLISKSIP-GRSGKSCRLRWCNQ 59
                     79******************************.***********985 PP

2Myb_DNA-binding53.46.1e-1769110447
                      S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +T+eEd+ +++a++++G++ W+tIar ++ gRt++ +k++w++ 
  Carubv10023692m  69 FTAEEDDAIIRAHARFGNK-WATIARLLN-GRTDNAIKNHWNST 110
                      8******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129425.612964IPR017930Myb domain
SuperFamilySSF466891.5E-3111107IPR009057Homeodomain-like
SMARTSM007173.4E-171362IPR001005SANT/Myb domain
PfamPF002491.6E-191459IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-261567IPR009057Homeodomain-like
CDDcd001672.89E-161658No hitNo description
SMARTSM007172.6E-1465113IPR001005SANT/Myb domain
PROSITE profilePS5129419.6566115IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.8E-2268114IPR009057Homeodomain-like
PfamPF002492.5E-1469110IPR001005SANT/Myb domain
CDDcd001676.30E-1269111No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MTSGSTRKET DRIKGPWSPE EDDLLQSLVQ KHGPRNWSLI SKSIPGRSGK SCRLRWCNQL  60
SPEVEHRGFT AEEDDAIIRA HARFGNKWAT IARLLNGRTD NAIKNHWNST LKRKCSGGGG  120
GGEKGQSCGF GGNGGYDGNL TDEQPLKRTA SGGYSGVGVV VTALSPTGSD VSEQLSGSVI  180
PVSSSRVFKP TARAGGVVIE SSSTSEEEEK DPATCLSLSL SWVNSESTPG RRDTAELFPV  240
KREEEEEKER GINGFGGDFM TVVQEMIKTE VRSYMTDLQL GNGGGSGGRG GGGASSCMVQ  300
GSGELGSY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A6e-41131153105MYB PROTO-ONCOGENE PROTEIN
1h88_C3e-401311557159MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-401311557159MYB PROTO-ONCOGENE PROTEIN
1mse_C5e-41131153105C-Myb DNA-Binding Domain
1msf_C5e-41131153105C-Myb DNA-Binding Domain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1286292GGRGGGG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00274DAPTransfer from AT2G23290Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0880070.0AY088007.1 Arabidopsis thaliana clone 40307 mRNA, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006294656.10.0hypothetical protein CARUB_v10023692mg
SwissprotQ9FDW17e-90MYB44_ARATH; Transcription factor MYB44
TrEMBLR0HDE80.0R0HDE8_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.4__260__AT2G23290.11e-147(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM67728135
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G23290.11e-132myb domain protein 70